Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1lj5A01 | 1 | 170 |
| 1lj5A01 | 281 | 325 |
| 1lj5A01 | 336 | 345 |
| 1lj5A02 | 171 | 280 |
| 1lj5A02 | 326 | 335 |
| 1lj5A02 | 346 | 379 |
There are 4 matching structural neighberhood comparisons for CATH ID 2.30.39.10.9.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3f02B02 | 79.66 | 2.30.39.10 | 99 | 35 | 64 | 3.08 | 4.79 | |
![]() |
2h4pA02 | 78.95 | 2.30.39.10 | 102 | 27 | 62 | 3.10 | 4.92 | |
![]() |
1hp7A01 | 78.43 | 2.30.39.10 | 95 | 29 | 61 | 2.70 | 4.38 | |
![]() |
1mtpA02 | 76.65 | 2.30.39.10 | 91 | 24 | 59 | 2.87 | 4.86 |
>pdb|1lj5A02 FNGQWKTPFPDSSTHRRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSAL TNILSAQLISHWKGNMTRLPRLLVLPKFSLIEVNESGTVARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVMEP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"