CATH Domain: 1lj5A01 XML data for domain: 1lj5A01

Molscript image for 1lj5A01
1lj5A01
PDB coordinates for domain 1lj5A01

PDB 1lj5, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.5
3.30.497.10.5.1
3.30.497.10.5.1.1
3.30.497.10.5.1.1.1
3.30.497.10.5.1.1.1.1

[top]
Segment boundaries for domain 1lj5A01

Chopping figure for domain 1lj5A01
DomainStart PDB ResidueStop PDB Residue
1lj5A01 1 170
1lj5A01 281 325
1lj5A01 336 345
1lj5A02 171 280
1lj5A02 326 335
1lj5A02 346 379

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.30.497.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wz9A01 85.44 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 23 94 3.42 3.63
1imvA02 84.85 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 18 91 2.92 3.20
1k9oI01 84.40 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 29 94 3.04 3.23
1uhgA02 84.24 OvalbuminGallus gallus 3.30.497.10 232 23 90 3.17 3.52
1jmoA01 84.12 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 3.30.497.10 227 16 93 3.37 3.61
1f0cA01 84.09 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 161 22 71 2.60 3.66
2b5tI01 82.88 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 21 84 4.19 4.93
1m93B01 79.20 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 127 22 56 1.77 3.14
1jjoC01 78.27 Mus musculusNeuroserpin 3.30.497.10 149 23 53 1.93 3.59
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lj5A01
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYK
ELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQL
TRLVLVNALYETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKSSSTAVIVSA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lj5A01
VHHPPSYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYK
ELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQL
TRLVLVNALYETEVDLRKPLENLGMTDMFRQFQADFTSLSDQEPLHVAQALQKVKSSSTAVIVSA
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"