CATH Domain: 1lfwA01 XML data for domain: 1lfwA01

Molscript image for 1lfwA01
1lfwA01
PDB coordinates for domain 1lfwA01

PDB 1lfw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.8
3.40.630.10.8.1
3.40.630.10.8.1.1
3.40.630.10.8.1.1.1
3.40.630.10.8.1.1.1.1

[top]
Segment boundaries for domain 1lfwA01

Chopping figure for domain 1lfwA01
DomainStart PDB ResidueStop PDB Residue
1lfwA01 1 186
1lfwA01 381 468
1lfwA02 187 204
1lfwA02 293 380
1lfwA03 205 292

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.40.630.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vgyA01 84.87 Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase 3.40.630.10 256 19 87 2.28 2.61
3ct9B01 84.40 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 18 84 2.04 2.41
1cg2A01 83.97 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 21 92 2.92 3.16
2rb7A01 82.71 Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20 3.40.630.10 231 18 79 2.66 3.36
1vheA01 81.00 Bacillus subtilisPutative aminopeptidase ysdC 3.40.630.10 268 14 82 3.04 3.67
1xmbA01 80.96 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.40.630.10 274 11 90 3.46 3.81
2qyvA01 80.88 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 15 85 3.43 4.00
1y0yA01 80.80 Endoglucanase [EC:3.2.1.4]Starch and sucrose metabolismPyrococcus horikoshiiTetrahedral aminopeptidase 3.40.630.10 254 14 82 2.79 3.38
1z2lB01 80.16 Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding 3.40.630.10 295 13 77 2.56 3.28
2greA01 80.15 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 12 80 2.93 3.65
2cf4A01 79.55 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 16 78 2.55 3.23
2v8hA01 78.53 Beta-alanine synthaseLachancea kluyveri 3.40.630.10 315 10 73 2.92 3.98
1vhoA01 77.33 Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase 3.40.630.10 237 13 77 3.08 3.96
3kasA01 77.28 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 8 75 3.07 4.09
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lfwA01
MDLNFKELAEAKKDAILKDLEELIAIDSSEDLENATEEYPVGKGPVDAMTKFLSFAKRDGFDTENFANYAGRVNFGAGDK
RLGIIGHMDVVPAGEGWTRDPFKMEIDEEGRIYGRGSADDKGPSLTAYYGMLLLKEAGFKPKKKIDFVLGTNEETNWVGI
DYYLKHEPTPDIVFSPDAEYPIINGEEPHYVPGSDPMVQTLLKVYEKQTGKPGHEVVIGGGTYGRLFERGVAFGAQPENG
PMVMHAANEFMMLDDLILSIAIYAEAIYELTKDE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lfwA01
MDLNFKELAEAKKDAILKDLEELIAIDSSEDLENATEEYPVGKGPVDAMTKFLSFAKRDGFDTENFANYAGRVNFGAGDK
RLGIIGHMDVVPAGEGWTRDPFKMEIDEEGRIYGRGSADDKGPSLTAYYGMLLLKEAGFKPKKKIDFVLGTNEETNWVGI
DYYLKHEPTPDIVFSPDAEYPIINGEEPHYVPGSDPMVQTLLKVYEKQTGKPGHEVVIGGGTYGRLFERGVAFGAQPENG
PMVMHAANEFMMLDDLILSIAIYAEAIYELTKDEEL
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by lewis on 09 Jan 2007 13:16

Assigning domain 1lfwA01 to 3.40.630.10 (as agreed with the CATH update team) after the chain has been rechopped. The reason is that the domain is very similar to the old domain 1lfwA01 (from the previous chopping at "Sun Mar 5 17:09:16 2006") which was in 3.40.630.10 at the time the chain was unchopped.

Flow stage update by auto on 06 Jan 2007 23:47

No satisfactory AssignClose result found.

Flow stage update by auto on 06 Jan 2007 23:40

No in_process hits for Domain "1lfwA01" ready to be processed

Flow stage update by auto on 06 Jan 2007 23:40

NW result present for Domain "1lfwA01"

Flow stage update by auto on 22 Dec 2006 19:34

All required files are present for Domain "1lfwA01"

Flow stage update by auto on 22 Dec 2006 15:43

Beginning processing for Domain "1lfwA01"

Insertion by cuff on 22 Dec 2006 14:42

small selection of choppings