CATH Domain: 1lfpA03 XML data for domain: 1lfpA03

Molscript image for 1lfpA03
1lfpA03
PDB coordinates for domain 1lfpA03

PDB 1lfp, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.980 Gene3D
3.30.70.980.1
3.30.70.980.1.1
3.30.70.980.1.1.1
3.30.70.980.1.1.1.1
3.30.70.980.1.1.1.1.1

[top]
Segment boundaries for domain 1lfpA03

Chopping figure for domain 1lfpA03
DomainStart PDB ResidueStop PDB Residue
1lfpA01 18 81
1lfpA02 82 132
1lfpA02 206 247
1lfpA03 133 205

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.30.70.980.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1konA03 91.31 UPF0082 protein yebCEscherichia coli K-12 3.30.70.980 75 32 94 1.20 1.27
1mw7A03 88.21 Helicobacter pyloriUPF0082 protein HP_0162 3.30.70.980 75 28 93 1.82 1.95
2nzcA00 80.15 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 6 81 3.77 4.61
1j4wA01 80.05 Transcription from RNA polymerase II promoterFar upstream element-binding proteinSequence-specific DNA binding transcription factor activityFar upstream element-binding protein 1Nucleus 3.30.1370.10 74 13 77 2.79 3.62
1ctfA00 79.96 Ribosome50S ribosomal protein L7/L12Large subunit ribosomal protein L7/L12Cytosolic large ribosomal subunitStructural constituent of ribosome 3.30.1390.10 68 7 83 3.51 4.20
1yx2A02 79.91 Nitrogen metabolismAminomethyltransferase [EC:2.1.2.10]One carbon pool by folateBacillus subtilisGlycine, serine and threonine metabolism 3.30.70.1400 81 9 70 2.71 3.85
1dtjA00 78.01 RNA-binding protein Nova-2Homo sapiens 3.30.1370.10 74 9 77 3.51 4.56
1vlyA02 77.81 RNA modificationTRNA-modifying protein ygfZFolic acid bindingEscherichia coli K-12 3.30.70.1400 84 4 72 2.65 3.65
2nocA01 77.16 Salmonella entericaPutative periplasmic protein 3.30.70.1310 71 15 61 2.81 4.56
2qyxB01 76.95 3.30.70.1360 109 10 61 2.90 4.72
3dnjB00 76.62 ATP-dependent Clp protease adaptor protein ClpSCaulobacter vibrioidesATP-dependent Clp protease adapter protein clpS 3.30.1390.10 75 1 82 3.77 4.56
1wr8A02 76.56 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 4 56 2.69 4.79
3proC02 76.43 Lysobacter enzymogenesAlpha-lytic protease 3.30.300.50 70 8 89 4.30 4.83
1utaA00 75.13 Membrane fractionCell cycle cytokinesisCell division protein FtsNCell division protein ftsNProtein binding 3.30.70.1070 77 6 89 3.75 4.18
2j8sA03 74.73 Hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 familyAcriflavine resistance protein BProtein bindingEscherichia coli K-12 3.30.70.1320 100 9 63 2.94 4.67
2hekA02 73.11 Aquifex aeolicusPutative uncharacterized protein 3.30.70.1370 88 8 56 2.48 4.36
[1]
Displaying entries 1 to 16 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lfpA03
LFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPIS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lfpA03
LFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPIS
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:01

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"