CATH Domain: 1lfpA02 XML data for domain: 1lfpA02

Molscript image for 1lfpA02
1lfpA02
PDB coordinates for domain 1lfpA02

PDB 1lfp, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1270 Hypothetical Protein Aq_1575; Chain: A;domain 2
3.30.1270.10 Gene3D
3.30.1270.10.1
3.30.1270.10.1.1
3.30.1270.10.1.1.1
3.30.1270.10.1.1.1.1
3.30.1270.10.1.1.1.1.1

[top]
Segment boundaries for domain 1lfpA02

Chopping figure for domain 1lfpA02
DomainStart PDB ResidueStop PDB Residue
1lfpA01 18 81
1lfpA02 82 132
1lfpA02 206 247
1lfpA03 133 205

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1270.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mw7A02 90.87 Helicobacter pyloriUPF0082 protein HP_0162 3.30.1270.10 87 31 89 1.41 1.58
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lfpA02
FEEVIYEGYAPGGVAVVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYTVQINDEETAQKVIKLLNALEELDDVQQVI
ANFEIPEEILQK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lfpA02
FEEVIYEGYAPGGVAVXVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYTVQINDEETAQKVIKLLNALEELDDVQQV
IANFEIPEEILQKVG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:09

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"