CATH Domain: 1lciA03 XML data for domain: 1lciA03

Molscript image for 1lciA03
1lciA03
PDB coordinates for domain 1lciA03

PDB 1lci, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.38 Luciferase; domain 3
2.30.38.10 Luciferase; Domain 3 Gene3D
2.30.38.10.3
2.30.38.10.3.1
2.30.38.10.3.1.1
2.30.38.10.3.1.1.1
2.30.38.10.3.1.1.1.1

[top]
Segment boundaries for domain 1lciA03

Chopping figure for domain 1lciA03
DomainStart PDB ResidueStop PDB Residue
1lciA01 56 213
1lciA02 214 355
1lciA03 359 435
1lciA04 441 544

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.30.38.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mdbA03 89.14 2,3-dihydroxybenzoate-AMP ligase [EC:2.7.7.58]Bacillus subtilis2,3-dihydroxybenzoate-AMP ligaseBiosynthesis of siderophore group nonribosomal peptides 2.30.38.10 76 26 94 1.56 1.65
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lciA03
PGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lciA03
PGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIV
BLAST against CATH

[top]
Domain History Events (3)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1lci003" to "1lciA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Domain assigned by lewis on 18 Jan 2007 19:39

Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.

Insertion by lewis on 18 Jan 2007 19:39

Rechopping chains just before release v3.1.0 in order to fix missing fragments.