CATH Domain: 1lc0A02 XML data for domain: 1lc0A02

Molscript image for 1lc0A02
1lc0A02
PDB coordinates for domain 1lc0A02

PDB 1lc0, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.1
3.30.360.10.1.1
3.30.360.10.1.1.1
3.30.360.10.1.1.1.1
3.30.360.10.1.1.1.1.1

[top]
Segment boundaries for domain 1lc0A02

Chopping figure for domain 1lc0A02
DomainStart PDB ResidueStop PDB Residue
1lc0A01 2 123
1lc0A01 245 265
1lc0A02 124 244
1lc0A02 266 291

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.360.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ho3C02 81.80 Oxidoreductase, Gfo/Idh/MocA familyStreptococcus pneumoniae 3.30.360.10 172 11 75 3.17 4.19
1h6dA02 79.40 Glucose-fructose oxidoreductase [EC:1.1.99.28]Zymomonas mobilisGlucose--fructose oxidoreductase 3.30.360.10 190 12 69 2.39 3.44
1tltA02 79.21 Virulence factorVirulence factor mviM homologEscherichia coli K-12 3.30.360.10 186 6 76 3.02 3.96
1xeaA02 77.75 Vibrio choleraeOxidoreductase, Gfo/Idh/MocA familyVirulence factor 3.30.360.10 187 12 75 3.79 4.99
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lc0A02
HVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQ
LETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGSAEDLAAEKKRIMHCLGLASDIQKLC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lc0A02
HVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQ
LETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGSAEDLAAEKKRIMHCLGLASDIQKLCHQKK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:08

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"