Set cath from cathlist by auto on 05 Mar 2006 19:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1lbvA01 | 1 | 138 |
| 1lbvA02 | 139 | 252 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.190.80.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3b8bA02 | 80.32 | 3.40.190.80 | 100 | 19 | 79 | 3.67 | 4.60 |
>pdb|1lbvA02 RIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTEL DGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"