CATH Domain: 1lb3A00 XML data for domain: 1lb3A00

Molscript image for 1lb3A00
1lb3A00
PDB coordinates for domain 1lb3A00

PDB 1lb3, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.1
1.20.1260.10.1.1
1.20.1260.10.1.1.1
1.20.1260.10.1.1.1.1
1.20.1260.10.1.1.1.1.1

[top]
Segment boundaries for domain 1lb3A00

Chopping figure for domain 1lb3A00
DomainStart PDB ResidueStop PDB Residue
1lb3A00 6 184

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3a9qE00 93.26 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 40 92 1.01 1.09
1vlgA00 92.61 Porphyrin and chlorophyll metabolismThermotoga maritimaFerritin [EC:1.16.3.1]Ferritin 1.20.1260.10 164 25 95 1.45 1.51
3bvfA00 89.98 Ferritin [EC:1.16.3.1]FerritinPorphyrin and chlorophyll metabolismHelicobacter pylori J99 1.20.1260.10 157 17 88 1.55 1.75
3fvbA00 89.75 BacterioferritinBrucella melitensis biovar Abortus 2308Bacterioferritin 1.20.1260.10 161 15 95 2.58 2.69
1nfvA00 88.57 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 13 94 2.74 2.91
2fjcB00 87.10 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 10 86 3.35 3.86
1o9rA00 86.87 Agrobacterium tumefaciens str. C58DNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 162 10 89 2.81 3.15
1jigA00 86.48 Bacillus anthracisStarvation-inducible DNA-binding proteinDNA protection during starvation protein 1 1.20.1260.10 146 13 83 2.23 2.68
2qqyA00 86.25 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 79 2.52 3.17
1lkoA01 86.21 Desulfovibrio vulgaris str. HildenboroughIron ion bindingRubrerythrin 1.20.1260.10 145 14 86 3.24 3.73
2yw6B00 86.00 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 12 84 2.46 2.92
1tjoB00 85.92 DNA protection during starvation proteinHalobacterium salinarum 1.20.1260.10 175 12 88 3.51 3.99
3kwoA00 85.80 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 11 83 3.07 3.69
2rbdA01 83.76 BH2358 proteinBacillus halodurans 1.20.1260.10 142 7 80 3.70 4.62
2oh3A01 83.71 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 9 75 2.81 3.73
1jkvA01 83.37 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 10 73 3.39 4.61
3bt5A00 83.21 Deinococcus radioduransPutative uncharacterized protein 1.20.1260.10 148 8 78 2.67 3.41
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1lb3A00
SQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQDV
QKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVASLGEYL
FERLTLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1lb3A00
TSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAERLLEFQNDRGGRALFQD
VQKPSQDEWGKTQEAMEAALAMEKNLNQALLDLHALGSARADPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPA
QTGAPQGSLGEYLFERLTLKHD
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:21

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:43

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"