CATH Domain: 1labA00 XML data for domain: 1labA00

Molscript image for 1labA00
1labA00
PDB coordinates for domain 1labA00

PDB 1lab, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.100 Gene3D
2.40.50.100.18
2.40.50.100.18.1
2.40.50.100.18.1.1
2.40.50.100.18.1.1.1
2.40.50.100.18.1.1.1.1

[top]
Segment boundaries for domain 1labA00

Chopping figure for domain 1labA00
DomainStart PDB ResidueStop PDB Residue
1labA00 1 80

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1labA00
AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1labA00
AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1lab000" to "1labA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 18:30

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:30

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 14:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"