CATH Domain: 1l8nA01 XML data for domain: 1l8nA01

Molscript image for 1l8nA01
1l8nA01
PDB coordinates for domain 1l8nA01

PDB 1l8n, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.379 Chitobiase; domain 2
3.30.379.10 Chitobiase, domain 2 Gene3D
3.30.379.10.2
3.30.379.10.2.1
3.30.379.10.2.1.1
3.30.379.10.2.1.1.1
3.30.379.10.2.1.1.1.1

Segment boundaries for domain 1l8nA01

Chopping figure for domain 1l8nA01
DomainStart PDB ResidueStop PDB Residue
1l8nA01 16 140
1l8nA02 141 473
1l8nA03 474 678

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.379.10.2.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jakA02 81.38 B-N-acetylhexosaminidaseStreptomyces plicatus 3.30.379.10 141 17 75 3.09 4.11
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1l8nA01
DQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRS
DVDPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQP    

Domain COMBS Sequence

>pdb|1l8nA01
DQYSRLRFEEIVAKRTSPIFQAAVEELQKGLRSMMEIEPQVVQEVNETANSIWLGTLEDEEFERPLEGTLVHPEGYVIRS
DVDDGPFRIYIIGKTDAGVLYGVFHFLRLLQMGENIAQLSIIEQP    

Domain History Events (13)

Domain assigned by auto on 11 Mar 2009 21:17

Assigning to "3.30.379.10" based on similarity with "1k9dA01"

Flow stage update by auto on 11 Mar 2009 21:15

No in_process hits for Domain "1l8nA01" ready to be processed

Update comment by auto on 11 Mar 2009 21:12

Domain "1l8nA01" hits Domain "1k9dA01" (100% over 100%) which is currently in process

Update comment by auto on 11 Mar 2009 21:02

Domain "1l8nA01" hits Domain "1k9eA01" (99.2% over 100%) which is currently in process

Update comment by auto on 23 Jul 2008 18:04

Domain "1l8nA01" hits Domain "1k9fA01" (99.2% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:11

Domain "1l8nA01" hits Domain "1k9fA01" (99.2% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:18

Domain "1l8nA01" hits Domain "1k9fA01" (99.2% over 100%) which is currently in process

Update comment by auto on 14 Aug 2007 22:44

Domain "1l8nA01" hits Domain "1k9fA01" (99.2% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:08

Domain "1l8nA01" hits Domain "1k9fA01" (99.2% over 100%) which is currently in process

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1l8nA01"

Flow stage update by auto on 14 Mar 2007 15:02

All required files are present for Domain "1l8nA01"

Flow stage update by auto on 14 Mar 2007 15:00

Beginning processing for Domain "1l8nA01"

Insertion by auto on 22 Dec 2006 19:25

Final ChopClose added based on similarity with "1k9dA"