CATH Domain: 1l7mA02 XML data for domain: 1l7mA02

Molscript image for 1l7mA02
1l7mA02
PDB coordinates for domain 1l7mA02

PDB 1l7m, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.210 Phosphoserine phosphatase; domain 2 Gene3D
1.10.150.210.1
1.10.150.210.1.1
1.10.150.210.1.1.1
1.10.150.210.1.1.1.1
1.10.150.210.1.1.1.1.1

Segment boundaries for domain 1l7mA02

Chopping figure for domain 1l7mA02
DomainStart PDB ResidueStop PDB Residue
1l7mA01 3 16
1l7mA01 78 210
1l7mA02 17 77

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1l7mA02
VNNETIDEIAREAGVEEEVKKITKEAEGKLNFEQSLRKRVSLLKDLPIEKVEKAIKRITP    

Domain COMBS Sequence

>pdb|1l7mA02
VNNETIDEIAREAGVEEEVKKITKEAXEGKLNFEQSLRKRVSLLKDLPIEKVEKAIKRITP    

Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:07

Assigning to "1.10.150.210" based on similarity with "1j97B02" (NWSI: 98.3606557377049, NWO: 100, SPS: 99.18, SPO: 98, RMSD: 0.11)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1l7mA02"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1l7mA02"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1l7mA02"

Insertion by auto on 05 Mar 2006 17:08

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"