CATH Domain: 1l6rA02 XML data for domain: 1l6rA02

Molscript image for 1l6rA02
1l6rA02
PDB coordinates for domain 1l6rA02

PDB 1l6r, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1070 Hypothetical Protein Ta0175; Chain: A, domain 2
3.90.1070.10 Gene3D
3.90.1070.10.3
3.90.1070.10.3.1
3.90.1070.10.3.1.1
3.90.1070.10.3.1.1.1
3.90.1070.10.3.1.1.1.1

[top]
Segment boundaries for domain 1l6rA02

Chopping figure for domain 1l6rA02
DomainStart PDB ResidueStop PDB Residue
1l6rA01 2 80
1l6rA01 146 223
1l6rA02 81 144

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 3.90.1070.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1xviA02 81.28 Fructose and mannose metabolismMannosyl-3-phosphoglycerate phosphatase [EC:3.1.3.70]Putative mannosyl-3-phosphoglycerate phosphataseProtein bindingEscherichia coli K-12 3.30.980.20 91 14 68 2.34 3.43
1mlaA01 78.01 Fatty acid biosynthesisMetabolic pathwaysMalonyl CoA-acyl carrier protein transacylase[acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]Escherichia coli K-12 3.30.70.250 73 12 79 3.49 4.39
2dy1A03 77.33 Thermus thermophilus HB8Elongation factor EF-G [EC:3.6.5.3]Elongation factor G (EF-G-2) 3.30.70.870 76 6 73 3.67 4.98
1in0A01 77.26 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 7 77 3.47 4.50
1opzA00 77.01 Cu2+-exporting ATPase [EC:3.6.3.4]Bacillus subtilisCopper-exporting P-type ATPase A 3.30.70.100 76 9 76 3.58 4.69
1vi7A02 76.28 IMPACT family member yigZProtein bindingEscherichia coli K-12 3.30.70.240 71 4 52 2.37 4.55
1wqgA02 76.09 Ribosome recycling factorMycobacterium tuberculosisRibosome-recycling factor 3.30.1360.40 75 7 76 3.62 4.76
2wriY03 75.92 Thermus thermophilus HB8Elongation factor GElongation factor EF-G [EC:3.6.5.3] 3.30.70.870 76 4 76 3.34 4.38
1eayD00 75.70 Bacterial chemotaxisTwo-component systemTwo-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]Escherichia coli K-12Chemotaxis protein cheA 3.30.70.400 69 4 76 3.84 5.00
2qifA00 75.07 Bacillus subtilisCopper chaperone copZ 3.30.70.100 69 7 76 3.62 4.71
2kt2A00 74.05 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 7 78 3.43 4.38
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1l6rA02
FSNEGTNKFLEEMSKRTSMRSILTNRWREASTGFDIDPEDVDYVRKEAESRGFVIFYSGYSWHL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1l6rA02
FSNEGTNKFLEEMSKRTSMRSILTNRWREASTGFDIDPEDVDYVRKEAESRGFVIFYSGYSWHL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:36

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"