CATH Domain: 1l5jA05 XML data for domain: 1l5jA05

Molscript image for 1l5jA05
1l5jA05
PDB coordinates for domain 1l5jA05

PDB 1l5j, Chain A, Domain 5

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.499 Aconitase; domain 3
3.30.499.10 Aconitase, domain 3 Gene3D
3.30.499.10.3
3.30.499.10.3.1
3.30.499.10.3.1.1
3.30.499.10.3.1.1.1
3.30.499.10.3.1.1.1.1

Segment boundaries for domain 1l5jA05

Chopping figure for domain 1l5jA05
DomainStart PDB ResidueStop PDB Residue
1l5jA01 1 161
1l5jA02 162 361
1l5jA03 382 401
1l5jA03 530 682
1l5jA04 402 529
1l5jA05 683 862

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|1l5jA05
CAPNDPDDARPLSAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGA
RIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVDTYR
YLNFNQLSQYTEKADGVIFQ    

Domain COMBS Sequence

>pdb|1l5jA05
CAPNDPDDARPLSAVQGEKIDEVFIGSCMTNIGHFRAAGKLLDAHKGQLPTRLWVAPPTRMDAAQLTEEGYYSVFGKSGA
RIEIPGCSLCMGNQARVADGATVVSTSTRNFPNRLGTGANVFLASAELAAVAALIGKLPTPEEYQTYVAQVDKTAVDTYR
YLNFNQLSQYTEKADGVIFQTAV    

Domain History Events (11)

Domain assigned by auto on 11 Mar 2009 21:11

Assigning to "3.30.499.10" based on similarity with "1l5jB05"

Flow stage update by auto on 11 Mar 2009 21:02

No in_process hits for Domain "1l5jA05" ready to be processed

Update comment by auto on 23 Jul 2008 18:04

Domain "1l5jA05" hits Domain "1l5jB05" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 20:11

Domain "1l5jA05" hits Domain "1l5jB05" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:18

Domain "1l5jA05" hits Domain "1l5jB05" (100% over 100%) which is currently in process

Update comment by auto on 18 Aug 2007 14:32

Domain "1l5jA05" hits Domain "1l5jB05" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Aug 2007 14:31

Domain "1l5jA05" hits Domain "1l5jB05" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Aug 2007 14:31

NW result present for Domain "1l5jA05"

Flow stage update by auto on 16 Aug 2007 17:15

All required files are present for Domain "1l5jA05"

Flow stage update by auto on 16 Aug 2007 00:02

Beginning processing for Domain "1l5jA05"

Insertion by auto on 15 Aug 2007 18:15

Final ChopClose added based on similarity with "1l5jB"