Domain assigned by auto on 28 Apr 2006 18:06
Assigning to "2.170.150.20" based on similarity with "1l1dA00" (NWSI: 98.6842105263158, NWO: 100, SPS: 97.94, SPO: 97, RMSD: 0.41)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1l1dB00 AATYKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSV TEHDDFSFNRRTEVRSRAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQDAAGYGALKGEV
Assigning to "2.170.150.20" based on similarity with "1l1dA00" (NWSI: 98.6842105263158, NWO: 100, SPS: 97.94, SPO: 97, RMSD: 0.41)
NW result present for Domain "1l1dB00"
All required files are present for Domain "1l1dB00"
Beginning processing for Domain "1l1dB00"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"