CATH Domain: 1l0wA03 XML data for domain: 1l0wA03

Molscript image for 1l0wA03
1l0wA03
PDB coordinates for domain 1l0wA03

PDB 1l0w, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.30 Gene3D
3.30.1360.30.1
3.30.1360.30.1.1
3.30.1360.30.1.1.1
3.30.1360.30.1.1.1.1
3.30.1360.30.1.1.1.1.1

[top]
Segment boundaries for domain 1l0wA03

Chopping figure for domain 1l0wA03
DomainStart PDB ResidueStop PDB Residue
1l0wA01 1 106
1l0wA02 137 277
1l0wA02 416 580
1l0wA03 278 415

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1360.30.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2p8tA02 79.83 Pyrococcus horikoshiiPutative uncharacterized protein PH0730 3.30.1360.30 109 12 76 3.33 4.38
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1l0wA03
SYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEG
GFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1l0wA03
SYEEAMERYGSDKPDLRFGLELKEVGPLFRQSGFRVFQEAESVKALALPKALSRKEVAELEEVAKRHKAQGLAWARVEEG
GFSGGVAKFLEPVREALLQATEARPGDTLLFVAGPRKVAATALGAVRLRAADLLGLKR
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:09

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:07

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"