Set cath from cathlist by auto on 05 Mar 2006 18:31
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1l0wA01 | 1 | 106 |
| 1l0wA02 | 137 | 277 |
| 1l0wA02 | 416 | 580 |
| 1l0wA03 | 278 | 415 |
There are 27 matching structural neighberhood comparisons for CATH ID 2.40.50.140.6.1.1.1.1 (SIMAX score < 5)
>pdb|1l0wA01 MRRTHYAGSLRETHVGEEVVLEGWVNRRRDLGGLIFLDLRDREGLVQLVAHPASPAYATAERVRPEWVVRAKGLVRLRPE PNPRLATGRVEVELSALEVLAEAKTP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"