Set cath from cathlist by auto on 05 Mar 2006 18:52
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kw3B01 | 1 | 132 |
| 1kw3B02 | 133 | 286 |
There are 9 matching structural neighberhood comparisons for CATH ID 3.10.180.10.6.1.1.1.1 (SIMAX score < 5)
>pdb|1kw3B01 SIERLGYLGFAVKDVPAWDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDAAALERMADKLR QAGVAFTRGDEALMQQRKVMGLLCLQDPFGLPLEIYYGPAEIFHEPFLPSAP
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"