Set cath from cathlist by auto on 05 Mar 2006 18:44
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1ktbA01 | 1 | 291 |
| 1ktbA02 | 298 | 388 |
There are 14 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.11.1.1.1.1 (SIMAX score < 5)
>pdb|1ktbA02 GRRIIKEGSHIEVFLRPLSQAASALVFFSRRTDMPFRYTTSLAKLGFPMGAAYEVQDVYSGKIISGLKTGDNFTVIINPS GVVMWYLCPKA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"