CATH Domain: 1ksiA02 XML data for domain: 1ksiA02

Molscript image for 1ksiA02
1ksiA02
PDB coordinates for domain 1ksiA02

PDB 1ksi, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.12
3.10.450.40.12.1
3.10.450.40.12.1.1
3.10.450.40.12.1.1.1
3.10.450.40.12.1.1.1.1

[top]
Segment boundaries for domain 1ksiA02

Chopping figure for domain 1ksiA02
DomainStart PDB ResidueStop PDB Residue
1ksiA01 6 101
1ksiA02 102 197
1ksiA03 231 646

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.450.40.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tu5B02 78.10 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 122 7 74 2.91 3.90
1nnvA01 73.26 Hypothetical proteinHaemophilus influenzaeUPF0263 protein HI_1450 3.10.450.140 100 3 88 4.37 4.97
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ksiA02
ILSVDEQSLAIKLPLKYPPFIDSVKKRGLNLSEIVCSSFTMGWFGEEKNVRTVRLDCFMKESTVNIYVRPITGITIVADL
DLMKIVEYHDRDIEAV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ksiA02
ILSVDEQSLAIKLPLKYPPFIDSVKKRGLNLSEIVCSSFTMGWFGEEKNVRTVRLDCFMKESTVNIYVRPITGITIVADL
DLMKIVEYHDRDIEAV
BLAST against CATH

[top]
Domain History Events (2)

Domain assigned by lewis on 18 Jan 2007 19:37

Reassigning this domain to its previous classification as part of fragment fixing process in preparation for release v3.1.0.

Insertion by lewis on 18 Jan 2007 19:37

Rechopping chains just before release v3.1.0 in order to fix missing fragments.