CATH Domain: 1ks9A02 XML data for domain: 1ks9A02

Molscript image for 1ks9A02
1ks9A02
PDB coordinates for domain 1ks9A02

PDB 1ks9, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1040 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2
1.10.1040.10 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 Gene3D
1.10.1040.10.7
1.10.1040.10.7.1
1.10.1040.10.7.1.1
1.10.1040.10.7.1.1.1
1.10.1040.10.7.1.1.1.1

[top]
Segment boundaries for domain 1ks9A02

Chopping figure for domain 1ks9A02
DomainStart PDB ResidueStop PDB Residue
1ks9A01 1 167
1ks9A02 168 290

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1040.10.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ew2A02 90.83 2-dehydropantoate 2-reductase [EC:1.1.1.169]Pantothenate and CoA biosynthesis2-dehydropantoate 2-reductaseMetabolic pathwaysEnterococcus faecalis 1.10.1040.10 132 30 92 1.64 1.77
2qytA02 84.61 Porphyromonas gingivalis2-dehydropantoate 2-reductase 1.10.1040.10 95 22 73 2.15 2.91
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ks9A02
NIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAENISSMLQ
DIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKES
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ks9A02
NIRAELWRKLAVNCVINPLTAIWNCPNGELRHHPQEIMQICEEVAAVIEREGHHTSAEDLRDYVMQVIDATAENISSMLQ
DIRALRHTEIDYINGFLLRRARAHGIAVPENTRLFEMVKRKES
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 05 Mar 2006 17:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"