Set cath from cathlist by auto on 05 Mar 2006 18:29
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1krhA01 | 2 | 104 |
| 1krhA02 | 105 | 201 |
| 1krhA03 | 202 | 335 |
There are 17 matching structural neighberhood comparisons for CATH ID 2.40.30.10.7.1.1.1.1 (SIMAX score < 5)
>pdb|1krhA02 KIHHFEGTLARVENLSDSTITFDIQLDDGQPDIHFLAGQYVNVTLPGTTETRSYSFSSQPGNRLTGFVVRNVPQGKMSEY LSVQAKAGDKMSFTGPF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"