CATH Domain: 1kpfA00 XML data for domain: 1kpfA00

Molscript image for 1kpfA00
1kpfA00
PDB coordinates for domain 1kpfA00

PDB 1kpf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.428 HIT family, subunit A
3.30.428.10 HIT family, subunit A Gene3D
3.30.428.10.4
3.30.428.10.4.1
3.30.428.10.4.1.1
3.30.428.10.4.1.1.1
3.30.428.10.4.1.1.1.1

[top]
Segment boundaries for domain 1kpfA00

Chopping figure for domain 1kpfA00
DomainStart PDB ResidueStop PDB Residue
1kpfA00 16 126

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.428.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1y23B01 89.15 Bacillus subtilisProtein hitHit-like protein involved in cell-cycle regulation 3.30.428.10 112 32 92 1.97 2.12
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kpfA00
DTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYR
MVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kpfA00
XADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIV
GKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
BLAST against CATH

[top]
Domain History Events (4)

Update comment by auto on 16 Oct 2007 19:44

Around September/October 2007, this domain was renamed from "1kpf000" to "1kpfA00" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 15:29

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"