CATH Domain: 1ko7A01 XML data for domain: 1ko7A01

Molscript image for 1ko7A01
1ko7A01
PDB coordinates for domain 1ko7A01

PDB 1ko7, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1390 Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1
3.40.1390.20 Gene3D
3.40.1390.20.1
3.40.1390.20.1.1
3.40.1390.20.1.1.1
3.40.1390.20.1.1.1.1
3.40.1390.20.1.1.1.1.1

[top]
Segment boundaries for domain 1ko7A01

Chopping figure for domain 1ko7A01
DomainStart PDB ResidueStop PDB Residue
1ko7A01 1 129
1ko7A02 130 288

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.1390.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1knxA01 87.68 HPr kinase/phosphorylaseMycoplasma pneumoniaeHPr kinase/phosphorylase [EC:2.7.11.- 2.7.4.-] 3.40.1390.20 133 24 96 2.13 2.21
2iojA00 82.33 Uncharacterized protein AF_1212Archaeoglobus fulgidus 3.40.1390.20 117 16 86 3.49 4.02
2hi6A00 76.02 Hypothetical proteinArchaeoglobus fulgidusUPF0107 protein AF_0055 3.50.30.10 132 10 73 3.58 4.87
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1ko7A01
MLTTKSLVERFELEMIAGEAGLNKQIKNTDISRPGLEMAGYFSHYASDRIQLLGTTELSFYNLLPDEERKGRMRKLCRPE
TPAIIVTRDLEPPEELIEAAKEHETPLITSKIATTQLMSRLTTFLEHEL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1ko7A01
MLTTKSLVERFELEMIAGEAGLNKQIKNTDISRPGLEMAGYFSHYASDRIQLLGTTELSFYNLLPDEERKGRMRKLCRPE
TPAIIVTRDLEPPEELIEAAKEHETPLITSKIATTQLMSRLTTFLEHEL
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:05

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"