Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kl7A01 | 2 | 94 |
| 1kl7A02 | 95 | 119 |
| 1kl7A02 | 243 | 476 |
| 1kl7A03 | 120 | 242 |
| 1kl7A03 | 477 | 511 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1kl7A01 PNASQVYRSTRSSSPKTISFEEAIIQGLATDGGLFIPPTIPQVDQATLFNDWSKLSFQDLAFAIRLYIAQEEIPDADLKD LIKRSYSTFRSD
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"