CATH Domain: 1kkeB01 XML data for domain: 1kkeB01

Molscript image for 1kkeB01
1kkeB01
PDB coordinates for domain 1kkeB01

PDB 1kke, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.10 Ribbon
2.10.25 Laminin
2.10.25.20 reovirus attachment protein sigma1; domain 1 Gene3D
2.10.25.20.2
2.10.25.20.2.1
2.10.25.20.2.1.1
2.10.25.20.2.1.1.1
2.10.25.20.2.1.1.1.2

[top]
Segment boundaries for domain 1kkeB01

Chopping figure for domain 1kkeB01
DomainStart PDB ResidueStop PDB Residue
1kkeB01 251 292
1kkeB02 315 455

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1kkeB01
QSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRST
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kkeB01
IGATEQSYVASAVTPLRLNSSTKVLDMLIDSSTLEINSSGQLTVRST
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:03

Assigning to "2.10.25.20" based on similarity with "1kkeA01" (NWSI: 100, NWO: 100, SPS: 94.97, SPO: 97, RMSD: 4.88)

Flow stage update by auto on 28 Apr 2006 17:49

NW result present for Domain "1kkeB01"

Flow stage update by auto on 28 Apr 2006 17:43

All required files are present for Domain "1kkeB01"

Flow stage update by auto on 27 Apr 2006 17:30

Beginning processing for Domain "1kkeB01"

Insertion by auto on 05 Mar 2006 17:04

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"