Insertion by sillitoe on 06 Mar 2006 15:33
HomCheck 'Assigned T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kkeA01 | 250 | 292 |
| 1kkeA02 | 315 | 455 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1kkeA02 FRQSMWIGIVSYSGSGLNWRVQVNSDIFIVDDYIHICLPAFDGFSIADGGDLSLNFVTGLLPPLLTGDTEPAFHNDVVTY GAQTVAIGLSSGGAPQYMSKNLWVEQWQDGVLRLRVEGGGSITHSNSKWPAMTVSYPRSFT
HomCheck 'Assigned T' domains
HomCheck 'Assigned T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"