Set cath from cathlist by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kjqB01 | 2 | 122 |
| 1kjqB02 | 123 | 196 |
| 1kjqB03 | 197 | 390 |
There are 5 matching structural neighberhood comparisons for CATH ID 3.30.470.20.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3ethA02 | 84.45 | 3.30.470.20 | 223 | 20 | 82 | 2.69 | 3.26 | |
![]() |
1a9xA06 | 81.05 | 3.30.470.20 | 203 | 13 | 81 | 4.07 | 4.98 | |
![]() |
2qf7B03 | 78.93 | 3.30.470.20 | 248 | 17 | 74 | 2.88 | 3.88 | |
![]() |
1gsoA03 | 75.82 | 3.30.470.20 | 139 | 9 | 61 | 2.84 | 4.59 | |
![]() |
1vkzA03 | 74.82 | 3.30.470.20 | 129 | 11 | 59 | 2.82 | 4.72 |
>pdb|1kjqB03 VVKFDFEITLLTVSAVDGVHFCAPVGHRQEDGDYRESWQPQQMSPLALERAQEIARKVVLALGGYGLFGVELFVCGDEVI FSEVSPRPHDTGMVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVTFDNVQNAVGADLQIRLFGKP EIDGSRRLGVALATAESVVDAIERAKHAAGQVKV
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"