CATH Domain: 1kjqA02 XML data for domain: 1kjqA02

Molscript image for 1kjqA02
1kjqA02
PDB coordinates for domain 1kjqA02

PDB 1kjq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.1
3.30.1490.20.1.1
3.30.1490.20.1.1.1
3.30.1490.20.1.1.1.1
3.30.1490.20.1.1.1.1.1

[top]
Segment boundaries for domain 1kjqA02

Chopping figure for domain 1kjqA02
DomainStart PDB ResidueStop PDB Residue
1kjqA01 2 122
1kjqA02 123 196
1kjqA03 197 391

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1a9xA03 90.28 3.30.1490.20 70 17 91 1.31 1.43
1bxrA07 89.72 3.30.1490.20 70 15 91 1.49 1.63
3g8dB03 87.37 Pyruvate metabolismFatty acid biosynthesisPropanoate metabolismMetabolic pathwaysFatty acid biosynthetic process 3.30.1490.20 73 19 86 2.04 2.36
1w96A03 86.81 Endoplasmic reticulum membraneAcetyl-CoA carboxylaseProtein import into nucleusBiotin carboxylase [EC:6.3.4.14]Nuclear envelope organization 3.30.1490.20 63 14 81 1.34 1.64
1ehiA03 86.63 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 19 83 2.06 2.48
1gsaA03 86.19 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 7 83 2.77 3.33
2yw2A02 86.11 Phosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathwaysAquifex aeolicus 3.30.1490.20 70 18 88 2.55 2.87
1vkzA02 85.76 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 15 88 2.53 2.85
1iowA03 85.74 D-Alanine metabolismPeptidoglycan biosynthesisD-alanine--D-alanine ligase BD-alanine-D-alanine ligase [EC:6.3.2.4]Escherichia coli K-12 3.30.1490.20 73 18 83 2.31 2.76
1i7nA01 84.21 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 8 78 2.20 2.79
2nu8B02 82.25 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 16 75 2.48 3.31
3ethA03 81.80 Purine metabolismMetabolic pathways5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]Phosphoribosylaminoimidazole carboxylase ATPase subunitEscherichia coli K-12 3.30.1490.20 62 24 80 2.28 2.84
2r6fA03 78.41 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 10 76 2.74 3.60
1vajA02 77.76 Hypothetical proteinPyrococcus horikoshiiProtein PH0010 3.30.1490.150 74 5 79 3.98 4.99
1x9nA02 70.11 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 7 63 3.04 4.76
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kjqA02
EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSKGQTFIRSAEQLAQAWKYAQQGGRAGAGRVIVEG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kjqA02
EELQLPTSTYRFADSESLFREAVADIGYPCIVKPVMSSSGKGQTFIRSAEQLAQAWKYAQQGGRAGAGRVIVEG
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:10

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:04

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"