CATH Domain: 1kg2A02 XML data for domain: 1kg2A02

Molscript image for 1kg2A02
1kg2A02
PDB coordinates for domain 1kg2A02

PDB 1kg2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.340 Endonuclease III; domain 1
1.10.340.30 Hypothetical protein; domain 2 Gene3D
1.10.340.30.2
1.10.340.30.2.1
1.10.340.30.2.1.1
1.10.340.30.2.1.1.1
1.10.340.30.2.1.1.1.1

[top]
Segment boundaries for domain 1kg2A02

Chopping figure for domain 1kg2A02
DomainStart PDB ResidueStop PDB Residue
1kg2A01 1 20
1kg2A01 133 224
1kg2A02 21 132

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.340.30.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1keaA02 91.58 G/T mismatches repair enzymeMethanothermobacter thermautotrophicus 1.10.340.30 113 27 99 1.49 1.50
1ornA01 91.16 1.10.340.30 112 26 97 1.68 1.73
1m3qA03 83.66 Endonuclease activityN-glycosylase/DNA lyaseBase excision repairN-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]Homo sapiens 1.10.340.30 126 25 80 2.52 3.14
1mpgA02 82.63 Base excision repairDNA dealkylation involved in DNA repairDNA-3-methyladenine glycosylase 2DNA-3-methyladenine glycosylase II [EC:3.2.2.21]Protein binding 1.10.340.30 118 19 82 2.83 3.44
1ngnA00 82.55 DNA damage response, signal transduction resulting in induction of apoptosisDNA methylationNucleusChromatinMus musculus 1.10.340.30 144 19 72 2.17 2.98
1pu6A02 82.10 Helicobacter pyloriEndonuclease IIIEndonuclease III related protein 1.10.340.30 123 15 85 3.27 3.83
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kg2A02
TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLH
GGKFPETFEEVAALPGVGRSTAGAILSLSLGK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kg2A02
TLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYYARARNLHKAAQQVATLH
GGKFPETFEEVAALPGVGRSTAGAILSLSLGK
BLAST against CATH

[top]
Domain History Events (5)

Classification merge by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Flow stage update by cuff on 25 Apr 2006 18:16

COMMENT: Mark - Clearly a homology missed during Homcheck FINAL: Lesley - Yes, clearly related. Mark, why were these not picked up during homolcheck???Lesley - Conservatively, Merge 10 into 30 for now, until better HMM hits allow us to clearly bring it into 10. They have strong functional correlations but the HMM hits are no present to any previously existing members of 10. Only a new one going into 10 and that call now being reconsidered in light of these X-hits.

Set cath from cathlist by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:08

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:03

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"