CATH Domain: 1kg2A01 XML data for domain: 1kg2A01

Molscript image for 1kg2A01
1kg2A01
PDB coordinates for domain 1kg2A01

PDB 1kg2, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1670 Endonuclease Iii, domain 2
1.10.1670.10 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) Gene3D
1.10.1670.10.4
1.10.1670.10.4.1
1.10.1670.10.4.1.1
1.10.1670.10.4.1.1.1
1.10.1670.10.4.1.1.1.1

[top]
Segment boundaries for domain 1kg2A01

Chopping figure for domain 1kg2A01
DomainStart PDB ResidueStop PDB Residue
1kg2A01 1 20
1kg2A01 133 224
1kg2A02 21 132

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.1670.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3g0qA01 92.30 Geobacillus stearothermophilusA/G-specific adenine glycosylase 1.10.1670.10 110 32 98 1.47 1.50
1keaA01 88.47 G/T mismatches repair enzymeMethanothermobacter thermautotrophicus 1.10.1670.10 104 25 87 1.90 2.17
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kg2A01
MQASQFSAQVLDWYDKYGRKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMIC
TRSKPKCSLCPLQNGCIAAANNSWALYPGKKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kg2A01
MQASQFSAQVLDWYDKYGRKHFPILDGNVKRVLARCYAVSGWPGKKEVENKLWSLSEQVTPAVGVERFNQAMMDLGAMIC
TRSKPKCSLCPLQNGCIAAANNSWALYPGKKPK
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:17

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:03

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"