CATH Domain: 1kfiA04 XML data for domain: 1kfiA04

Molscript image for 1kfiA04
1kfiA04
PDB coordinates for domain 1kfiA04

PDB 1kfi, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.310 TATA-Binding Protein
3.30.310.50 Major birch pollen allergen Bet v 1 Gene3D
3.30.310.50.2
3.30.310.50.2.1
3.30.310.50.2.1.1
3.30.310.50.2.1.1.1
3.30.310.50.2.1.1.1.1

[top]
Segment boundaries for domain 1kfiA04

Chopping figure for domain 1kfiA04
DomainStart PDB ResidueStop PDB Residue
1kfiA01 3 212
1kfiA02 213 321
1kfiA03 322 447
1kfiA04 448 572

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.310.50.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3pmgA04 86.04 Phosphoglucomutase-1Oryctolagus cuniculus 3.30.310.50 161 52 77 2.05 2.64
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kfiA04
SRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIR
IYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kfiA04
SRYDYEQVDSAGANKMMEHLKTKFQYFEQLKQGNKADIYDYVDPVDQSVSKNQGVRFVFGDGSRIIFRLSGTGSVGATIR
IYFEQFEQQQIQHETATALANIIKLGLEISDIAQFTGRNEPTVIT
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:03

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:03

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"