Set cath from cathlist by auto on 05 Mar 2006 19:24
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kfiA01 | 3 | 212 |
| 1kfiA02 | 213 | 321 |
| 1kfiA03 | 322 | 447 |
| 1kfiA04 | 448 | 572 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.120.10.9.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2fuvA02 | 82.85 | 3.40.120.10 | 92 | 19 | 77 | 2.26 | 2.90 |
>pdb|1kfiA02 MQKLFDFDLLKGLFSNKDFSFRFDGMHGVAGPYAKHIFGTLLGCSKESLLNCDPSEDFGGGHPDPNLTYAHDLVELLDIH KKKDVGTVPQFGAACDGDADRNMILGRQF
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"