Set cath from cathlist by auto on 05 Mar 2006 18:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1keiA02
1keiA02
PDB 1kei, Chain A, Domain 2
Segment boundaries for domain 1keiA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1keiA01 | 6 | 154 |
| 1keiA02 | 155 | 315 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.10.390.10.2.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
1trlA00 | 74.77 | 1.10.390.10 | 62 | 98 | 37 | 1.54 | 4.06 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1keiA02 LIYQNESGAINEAISDIFGTLVEFYANKNPDWEIGEDVYTPGISGDSLRSMSDPAKYGDPDHYSKRYTGTQDNGGVHINS GIINKAAYLISQGGTHYGVSVVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVG V
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 18:08
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:03
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
