Set cath from cathlist by auto on 05 Mar 2006 19:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kdgA01 | 215 | 345 |
| 1kdgA01 | 401 | 518 |
| 1kdgA01 | 617 | 633 |
| 1kdgA01 | 685 | 755 |
| 1kdgA02 | 346 | 400 |
| 1kdgA02 | 519 | 616 |
| 1kdgA02 | 634 | 684 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1kdgA02 PSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNSINLVFTHPSIDAYENWADVWSNPR PADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSPWLVNPV DKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPAT
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"