CATH Domain: 1kcxA01 XML data for domain: 1kcxA01

Molscript image for 1kcxA01
1kcxA01
PDB coordinates for domain 1kcxA01

PDB 1kcx, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.10
2.30.40.10.10.1
2.30.40.10.10.1.1
2.30.40.10.10.1.1.1
2.30.40.10.10.1.1.1.1

[top]
Segment boundaries for domain 1kcxA01

Chopping figure for domain 1kcxA01
DomainStart PDB ResidueStop PDB Residue
1kcxA01 15 67
1kcxA01 441 490
1kcxA02 68 440

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 2.30.40.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gkrA01 84.29 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 21 71 1.87 2.60
2qt3A01 83.73 N-isopropylammelide isopropyl amidohydrolasePseudomonas sp. ADP 2.30.40.10 100 18 68 1.66 2.41
2vhlB01 83.71 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine-6-phosphate deacetylaseBacillus subtilisN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 17 70 2.82 3.98
3feqA01 82.98 2.30.40.10 105 10 65 1.52 2.31
1yrrA01 82.03 Amino sugar and nucleotide sugar metabolismEscherichia coli O157:H7N-acetylglucosamine-6-phosphate deacetylaseN-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25] 2.30.40.10 92 17 66 2.06 3.12
1gkrB01 81.76 L-hydantoinaseArthrobacter aurescens 2.30.40.10 130 23 64 1.78 2.75
2icsA01 80.38 Pyrimidine metabolismDihydroorotase [EC:3.5.2.3]Metabolic pathwaysEnterococcus faecalisPutative uncharacterized protein 2.30.40.10 100 13 61 2.02 3.30
2qs8A01 79.90 2.30.40.10 99 13 66 2.19 3.32
2pajA01 79.79 2.30.40.10 119 16 58 1.60 2.72
3be7A01 79.48 2.30.40.10 95 16 63 1.98 3.14
1ejxC01 71.78 Arginine and proline metabolismKlebsiella aerogenesPurine metabolismUrease alpha subunit [EC:3.5.1.5]Atrazine degradation 2.30.40.10 185 17 40 1.81 4.46
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1kcxA01
DRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGSPLVVISQGKIVFEDGNISVSKGMGR
FIPRKPFPEHLYQRVRIRSKVFG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kcxA01
SIPHITSDRLLIRGGRIINDDQSFYADVYLEDGLIKQIGENLIVPGGVKTIEANGRMVIPGSPLVVISQGKIVFEDGNIS
VSKGMGRFIPRKPFPEHLYQRVRIRSKVFG
BLAST against CATH

[top]
Domain History Events (125)

Domain assigned by cuff on 19 Nov 2008 13:54

homology match

Homcheck review by tronnberg on 16 Jan 2008 10:06

SSAP: 85.5 OV: 70 SEQ: 38

Flow stage update by tronnberg on 16 Jan 2008 10:06

SSAP: 85.5 OV: 70 SEQ: 38

Domain assignment manual match h by tronnberg on 16 Jan 2008 10:06

SSAP: 85.5 OV: 70 SEQ: 38

Homcheck allotment by tronnberg on 16 Jan 2008 10:05

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 16 Jan 2008 10:05

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 14 Jan 2008 18:49

Calculated SCOP results for 1kcxA01 and inserted them into the database.

Domain scan scop cath by auto on 14 Jan 2008 18:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 12 results for 1kcxA01

Flow stage update by auto on 22 Dec 2007 15:13

Retrieved PRC_PFAMCATH results for job ID SID2230307222261344 and results inserted.

Domain scan prc pfamcath by auto on 22 Dec 2007 15:13

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 41 results for 1kcxA01

Update comment by auto on 22 Dec 2007 02:50

PRC_PFAMCATH job SID2230307222261344 is not yet finished.

Prc pfamcath submit by auto on 22 Dec 2007 02:48

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Dec 2007 02:48

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 22 Dec 2007 02:40

Retrieved SSAP results for job ID SID7056408637620536 and results inserted.

Domain scan ssap cath by auto on 22 Dec 2007 02:39

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 416 results for 1kcxA01

Update comment by auto on 21 Dec 2007 20:47

SSAP job SID7056408637620536 is not yet finished.

Ssap cath submit by auto on 21 Dec 2007 20:43

The entry "1kcxA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Dec 2007 20:43

The entry "1kcxA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 21 Dec 2007 20:33

Retrieved PRC results for job ID SID7619092682575064 and inserted them into the database.

Domain scan prc cath by auto on 21 Dec 2007 20:32

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 1kcxA01

Prc cath submit by auto on 21 Dec 2007 20:26

The entry "1kcxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 21 Dec 2007 20:26

The entry "1kcxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 21 Dec 2007 20:20

Retrieved HMM(SAM) results for job ID SID6973627137265156 and inserted them into the database.

Domain scan sam cath by auto on 21 Dec 2007 20:20

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 1kcxA01

Update comment by auto on 21 Dec 2007 18:07

HMM(SAM) job SID6973627137265156 is not yet finished.

Flow stage update by auto on 21 Dec 2007 18:02

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 21 Dec 2007 18:01

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 14:21

Unable to retrieve "1kcxA01" HMM(SAM) results for job "SID1501283897746484"

Update comment by auto on 21 Dec 2007 11:59

HMM(SAM) job SID1501283897746484 is not yet finished.

Flow stage update by auto on 21 Dec 2007 11:55

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 21 Dec 2007 11:55

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 08:54

Unable to retrieve "1kcxA01" HMM(SAM) results for job "SID7488134741338864"

Update comment by auto on 21 Dec 2007 05:28

HMM(SAM) job SID7488134741338864 is not yet finished.

Sam cath submit by auto on 21 Dec 2007 05:24

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 05:24

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 21 Dec 2007 03:02

Unable to retrieve "1kcxA01" HMM(SAM) results for job "SID9141758070246208"

Update comment by auto on 20 Dec 2007 23:40

HMM(SAM) job SID9141758070246208 is not yet finished.

Sam cath submit by auto on 20 Dec 2007 23:36

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 23:36

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 20:36

Unable to retrieve "1kcxA01" HMM(SAM) results for job "SID9700942826002304"

Update comment by auto on 20 Dec 2007 17:34

HMM(SAM) job SID9700942826002304 is not yet finished.

Flow stage update by auto on 20 Dec 2007 17:31

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 20 Dec 2007 17:31

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 14:48

Unable to retrieve "1kcxA01" HMM(SAM) results for job "SID9325598297957856"

Update comment by auto on 20 Dec 2007 11:37

HMM(SAM) job SID9325598297957856 is not yet finished.

Sam cath submit by auto on 20 Dec 2007 11:35

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 11:35

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 20 Dec 2007 11:33

Retrieved "1kcxA01" CATHEDRAL results for job ID SID4723555692344432 and inserted them into the database.

Domain scan cathedral cath by auto on 20 Dec 2007 11:33

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 19 results for 1kcxA01

Cathedral cath submit by auto on 20 Dec 2007 11:28

The entry "1kcxA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 20 Dec 2007 11:28

The entry "1kcxA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 20 Dec 2007 11:27

ScanList with 11654 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1kcxA01.scanlist" for "1kcxA01"

Write scan list by auto on 20 Dec 2007 11:27

Writing ScanList containing 11654 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1kcxA01.scanlist" for domain "1kcxA01"

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Domain scan prc pfamcath by auto on 25 Sep 2007 11:39

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 23 results for 1kcxA01

Flow stage update by auto on 17 Jul 2007 23:03

Retrieved PRC_PFAMCATH results for job ID SID3625066983316704 and chopping inserted.

Update comment by auto on 16 Jul 2007 19:58

PRC_PFAMCATH job SID3625066983316704 is not yet finished.

Flow stage update by auto on 16 Jul 2007 19:57

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 16 Jul 2007 19:57

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 16 Jul 2007 17:02

Giving up on PRC_PFAMCATH job SID1814196074543528 because submission time of Sat Jul 14 13:45:07 2007 is more than 172800 seconds older than current time (Mon Jul 16 17:02:48 2007).

Update comment by auto on 14 Jul 2007 13:46

PRC_PFAMCATH job SID1814196074543528 is not yet finished.

Flow stage update by auto on 14 Jul 2007 13:45

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 14 Jul 2007 13:45

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Jul 2007 07:35

Giving up on PRC_PFAMCATH job SID3917449303981376 because submission time of Thu Jul 12 06:28:36 2007 is more than 172800 seconds older than current time (Sat Jul 14 07:35:40 2007).

Update comment by auto on 12 Jul 2007 06:29

PRC_PFAMCATH job SID3917449303981376 is not yet finished.

Flow stage update by auto on 12 Jul 2007 06:28

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 12 Jul 2007 06:28

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 12 Jul 2007 04:29

Giving up on PRC_PFAMCATH job SID8284664320109952 because submission time of Tue Jul 10 03:07:08 2007 is more than 172800 seconds older than current time (Thu Jul 12 04:29:49 2007).

Update comment by auto on 10 Jul 2007 03:08

PRC_PFAMCATH job SID8284664320109952 is not yet finished.

Flow stage update by auto on 10 Jul 2007 03:07

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 10 Jul 2007 03:07

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 10 Jul 2007 01:22

Giving up on PRC_PFAMCATH job SID6933459478944033 because submission time of Sun Jul 8 00:49:01 2007 is more than 172800 seconds older than current time (Tue Jul 10 01:22:34 2007).

Update comment by auto on 08 Jul 2007 00:49

PRC_PFAMCATH job SID6933459478944033 is not yet finished.

Flow stage update by auto on 08 Jul 2007 00:49

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 08 Jul 2007 00:49

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 07 Jul 2007 22:35

Giving up on PRC_PFAMCATH job SID3603459858915136 because submission time of Thu Jul 5 21:39:08 2007 is more than 172800 seconds older than current time (Sat Jul 7 22:35:44 2007).

Update comment by auto on 05 Jul 2007 21:40

PRC_PFAMCATH job SID3603459858915136 is not yet finished.

Flow stage update by auto on 05 Jul 2007 21:39

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 05 Jul 2007 21:39

The entry "1kcxA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Jul 2007 20:34

Retrieved SSAP results for job ID SID3793497195950272 and chopping inserted.

Domain scan ssap cath by auto on 05 Jul 2007 20:33

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 302 results for 1kcxA01

Update comment by auto on 05 Jul 2007 11:46

SSAP job SID3793497195950272 is not yet finished.

Flow stage update by auto on 05 Jul 2007 10:41

The entry "1kcxA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 05 Jul 2007 10:41

The entry "1kcxA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 06:42

Retrieved PRC results for job ID SID3173562067330240 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 06:41

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 15 results for 1kcxA01

Update comment by auto on 04 Jul 2007 01:19

PRC job SID3173562067330240 is not yet finished.

Prc cath submit by auto on 04 Jul 2007 00:55

The entry "1kcxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Jul 2007 00:55

The entry "1kcxA01" has been submitted to the PRC webservice.

Flow stage update by auto on 03 Jul 2007 23:10

Retrieved HMM(SAM) results for job ID SID5642547022217056 and inserted them into the database.

Domain scan sam cath by auto on 03 Jul 2007 23:10

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 1kcxA01

Update comment by auto on 03 Jul 2007 09:34

HMM(SAM) job SID5642547022217056 is not yet finished.

Sam cath submit by auto on 03 Jul 2007 09:28

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 09:28

The entry "1kcxA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 08:15

Retrieved "1kcxA01" CATHEDRAL results for job ID SID7711652055477694 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 08:14

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 241 results for 1kcxA01

Cathedral cath submit by auto on 03 Jul 2007 07:20

The entry "1kcxA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 07:20

The entry "1kcxA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 06:06

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1kcxA01.scanlist" for "1kcxA01"

Write scan list by auto on 03 Jul 2007 06:06

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1kcxA01.scanlist" for domain "1kcxA01"

Update comment by auto on 03 Jul 2007 02:12

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:04

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:21

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:02

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:04

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:04

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:01

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:08

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:06

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:02

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:02

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:05

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:01

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:09

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:05

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:03

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:06

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:08

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:28

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:03

No satisfactory AssignClose result found.

Flow stage update by auto on 14 Mar 2007 15:08

No in_process hits for Domain "1kcxA01" ready to be processed

Flow stage update by auto on 14 Mar 2007 15:06

NW result present for Domain "1kcxA01"

Flow stage update by auto on 14 Mar 2007 15:01

All required files are present for Domain "1kcxA01"

Flow stage update by auto on 14 Mar 2007 14:59

Beginning processing for Domain "1kcxA01"

Insertion by auto on 05 Mar 2006 23:25

Cut based on decision in database "DomChop" on "cathdb"