Set cath from cathlist by auto on 05 Mar 2006 19:06
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kblA01 | 2 | 109 |
| 1kblA01 | 199 | 243 |
| 1kblA02 | 342 | 382 |
| 1kblA02 | 510 | 531 |
| 1kblA03 | 383 | 507 |
| 1kblA04 | 532 | 873 |
| 1kblA05 | 110 | 198 |
| 1kblA06 | 244 | 341 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1kblA06 FGNKGETSGTGVAFTRNPSTGEKGIYGEYLINAQGEDVVAGVRTPQPITQLENDMPDCYKQFMDLAMKLEKHFRDMQDME FTIEEGKLYFLQTRNGKR
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"