Set cath from cathlist by auto on 05 Mar 2006 19:30
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kblA01 | 2 | 109 |
| 1kblA01 | 199 | 243 |
| 1kblA02 | 342 | 382 |
| 1kblA02 | 510 | 531 |
| 1kblA03 | 383 | 507 |
| 1kblA04 | 532 | 873 |
| 1kblA05 | 110 | 198 |
| 1kblA06 | 244 | 341 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.50.30.10.1.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1zymA01 | 84.79 | 3.50.30.10 | 121 | 24 | 79 | 2.31 | 2.92 | |
![]() |
2olsA03 | 82.45 | 3.50.30.10 | 87 | 35 | 66 | 1.67 | 2.52 | |
![]() |
2hi6A00 | 80.20 | 3.50.30.10 | 132 | 15 | 76 | 3.40 | 4.44 |
>pdb|1kblA03 PAALKAGEVIGSALPASPGAAAGKVYFTADEAKAAHEKGERVILVRLETSPEDIEGMHAAEGILTVRGGMTSHAAVVARG MGTCCVSGCGEIKINEEAKTFELGGHTFAEGDYISLDGSTGKIYK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"