CATH Domain: 1kblA02 XML data for domain: 1kblA02

Molscript image for 1kblA02
1kblA02
PDB coordinates for domain 1kblA02

PDB 1kbl, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.189 Pyruvate Phosphate di-kinase; domain 2
1.10.189.10 Pyruvate Phosphate Dikinase, domain 2 Gene3D
1.10.189.10.1
1.10.189.10.1.1
1.10.189.10.1.1.1
1.10.189.10.1.1.1.1
1.10.189.10.1.1.1.1.1

[top]
Segment boundaries for domain 1kblA02

Chopping figure for domain 1kblA02
DomainStart PDB ResidueStop PDB Residue
1kblA01 2 109
1kblA01 199 243
1kblA02 342 382
1kblA02 510 531
1kblA03 383 507
1kblA04 532 873
1kblA05 110 198
1kblA06 244 341

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1kblA02
TAPAALQIACDLVDEGMITEEEAVVRIEAKSLDQLLHPTFNIETQEASVSGSFERIMVWADKF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1kblA02
TAPAALQIACDLVDEGMITEEEAVVRIEAKSLDQLLHPTFNIETQEASVSGSFERIMVWADKF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"