Set cath from cathlist by auto on 05 Mar 2006 19:10
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1kblA01
1kblA01
PDB 1kbl, Chain A, Domain 1
Segment boundaries for domain 1kblA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1kblA01 | 2 | 109 |
| 1kblA01 | 199 | 243 |
| 1kblA02 | 342 | 382 |
| 1kblA02 | 510 | 531 |
| 1kblA03 | 383 | 507 |
| 1kblA04 | 532 | 873 |
| 1kblA05 | 110 | 198 |
| 1kblA06 | 244 | 341 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.18.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2olsA01 | 87.21 | 3.30.1490.20 | 183 | 28 | 78 | 1.63 | 2.07 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1kblA01 AKWVYKFEEGNASMRNLLGGKGCNLAEMTILGMPIPQGFTVTTEACTEYYNSGKQITQEIQDQIFEAITWLEELNGKKFG DTEDPLLVSVRSGARASMPGMMDTILNLEPKDQLMGAVKAVFRSWDNPRAIVYRRMNDIPGDWGTAVNVQTMV
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 19:10
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:02
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
