Set cath from cathlist by auto on 05 Mar 2006 18:25
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k9oI01 | 11 | 179 |
| 1k9oI01 | 287 | 332 |
| 1k9oI02 | 180 | 286 |
| 1k9oI02 | 333 | 386 |
There are 1 matching structural neighberhood comparisons for CATH ID 2.30.39.10.17.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1imvA01 | 87.40 | 2.30.39.10 | 169 | 28 | 87 | 2.72 | 3.11 |
>pdb|1k9oI02 FKGSWKDKFVKERTMDRDFHVSKDKTIKVPTMIGKKDVRYADVPELDAKMIEMSYEGDQASMIIILPNQVDGITALEQKL KDPKALSRAEERLYNTEVEITLPKFKIIEVNEEGAEAAAANAFGIVPKSLILYPEVHIDRPFYFELKIDGIPMFNGKVIE P
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"