CATH Domain: 1k9oI01 XML data for domain: 1k9oI01

Molscript image for 1k9oI01
1k9oI01
PDB coordinates for domain 1k9oI01

PDB 1k9o, Chain I, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.9
3.30.497.10.9.1
3.30.497.10.9.1.1
3.30.497.10.9.1.1.1
3.30.497.10.9.1.1.1.1

[top]
Segment boundaries for domain 1k9oI01

Chopping figure for domain 1k9oI01
DomainStart PDB ResidueStop PDB Residue
1k9oI01 11 179
1k9oI01 287 332
1k9oI02 180 286
1k9oI02 333 386

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.30.497.10.9.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1imvA02 85.31 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 18 94 2.21 2.33
2b5tI01 84.13 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 27 83 2.38 2.87
1f0cA01 80.80 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 161 23 69 2.54 3.64
1jjoC01 76.40 Mus musculusNeuroserpin 3.30.497.10 149 26 52 2.18 4.18
1m93B01 75.61 Serine proteinase inhibitor 2Cowpox virus (Brighton Red) 3.30.497.10 127 24 55 2.71 4.86
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k9oI01
GETDLQKILRESNDQFTAQMFSEVVKANPGQNVVLSAFSVLPPLGQLALASVGESHDELLRALALPNDNVTKDVFADLNR
GVRAVKGVDLKMASKIYVAKGLELNDDFAAVSRDVFGSEVQNVDFVKSVEAAGAINKWVEDQTNNRIKNLVDPDALDETT
RSVLVNAIYETTTDLKEVLSNMNIKKLFTPGAARLENLLKTKESLTVDAAIQKAF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k9oI01
MAGETDLQKILRESNDQFTAQMFSEVVKANPGQNVVLSAFSVLPPLGQLALASVGESHDELLRALALPNDNVTKDVFADL
NRGVRAVKGVDLKMASKIYVAKGLELNDDFAAVSRDVFGSEVQNVDFVKSVEAAGAINKWVEDQTNNRIKNLVDPDALDE
TTRSVLVNAIYETTTDLKEVLSNMNIKKLFTPGAARLENLLKTKESLTVDAAIQKAF
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:06

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"