Set cath from cathlist by auto on 05 Mar 2006 19:15
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k92A01 | 1 | 72 |
| 1k92A01 | 101 | 188 |
| 1k92A02 | 73 | 100 |
| 1k92A02 | 189 | 375 |
| 1k92A03 | 376 | 439 |
There are 5 matching structural neighberhood comparisons for CATH ID 3.40.50.620.17.1.1.1.1 (SIMAX score < 5)
>pdb|1k92A01 TTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEEDYDAIPRRAMEYGAENARLIDCTTPLGRAV TGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELQIYKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVEK
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"