CATH Domain: 1k8kA03 XML data for domain: 1k8kA03

Molscript image for 1k8kA03
1k8kA03
PDB coordinates for domain 1k8kA03

PDB 1k8k, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.10
3.30.420.40.10.1
3.30.420.40.10.1.1
3.30.420.40.10.1.1.1
3.30.420.40.10.1.1.1.1

[top]
Segment boundaries for domain 1k8kA03

Chopping figure for domain 1k8kA03
DomainStart PDB ResidueStop PDB Residue
1k8kA01 4 34
1k8kA01 78 141
1k8kA01 375 411
1k8kA02 35 75
1k8kA03 143 196
1k8kA03 292 370
1k8kA04 197 288

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.420.40.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jcfA02 81.73 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 23 65 2.56 3.89
1e4fT04 79.07 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 20 67 2.62 3.88
2qxlA03 76.84 Adenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Protein refoldingHeat shock protein 110kDaCytoplasm 3.30.420.40 93 9 64 3.05 4.74
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k8kA03
VQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAFTQPISEVVDEVIQNCPIDVRRPLYK
NIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSKPKPIDVQVITH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k8kA03
VQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAFTQPISEVVDEVIQNCPIDVRRPLYK
NIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:05

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:02

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"