Insertion by sillitoe on 06 Mar 2006 15:53
HomCheck 'New T' domains
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k87A01 | 87 | 138 |
| 1k87A02 | 140 | 260 |
| 1k87A03 | 261 | 612 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1k87A02 NASGRAGMVQGLLQEFSLSSQEGVALMCLAEALLRIPDKATRDALIRDKISNGNRSPSLFVNAATWGLLFTGNEASLSRS LNRIIGKSGEPLIRKGVDMAMRLMGEQFV
HomCheck 'New T' domains
HomCheck 'New T' domains
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"