Set cath from cathlist by auto on 05 Mar 2006 18:04
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k7wA01 | 29 | 125 |
| 1k7wA01 | 197 | 236 |
| 1k7wA02 | 126 | 196 |
| 1k7wA02 | 237 | 366 |
| 1k7wA02 | 439 | 465 |
| 1k7wA03 | 367 | 438 |
There are 7 matching structural neighberhood comparisons for CATH ID 1.10.40.30.3.1.1.1.1 (SIMAX score < 5)
>pdb|1k7wA03 TPEMLATDLALYLVRKGVPFRQAHTASGKAVHLAETKGITINKLSLEDLKSISPQFSSDVSQVFNFVNSVEQ
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"