Set cath from cathlist by auto on 05 Mar 2006 19:26
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k7iA01 | 19 | 35 |
| 1k7iA01 | 263 | 479 |
| 1k7iA02 | 36 | 262 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1k7iA02 RGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDV ANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALG LAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSFWGENETGADYNGHYGGAPMIDDIAAIQRLYGANM
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"