Domain assigned by auto on 18 Aug 2007 10:17
Assigning to "2.170.11.10" based on similarity with "1t8iA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k4tA01 | 201 | 231 |
| 1k4tA01 | 320 | 431 |
| 1k4tA02 | 232 | 319 |
| 1k4tA03 | 432 | 586 |
| 1k4tA04 | 587 | 765 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1k4tA01 QKWKWWEEERYPEGIKWKFLEHKGPVFAPPYSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFRGRGNHP KMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNP
Assigning to "2.170.11.10" based on similarity with "1t8iA01"
No in_process hits for Domain "1k4tA01" ready to be processed
NW result present for Domain "1k4tA01"
All required files are present for Domain "1k4tA01"
Beginning processing for Domain "1k4tA01"
nice chopping