CATH Domain: 1k3yA02 XML data for domain: 1k3yA02

Molscript image for 1k3yA02
1k3yA02
PDB coordinates for domain 1k3yA02

PDB 1k3y, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.1
1.20.1050.10.1.1
1.20.1050.10.1.1.1
1.20.1050.10.1.1.1.1
1.20.1050.10.1.1.1.1.1

[top]
Segment boundaries for domain 1k3yA02

Chopping figure for domain 1k3yA02
DomainStart PDB ResidueStop PDB Residue
1k3yA01 2 81
1k3yA01 191 209
1k3yA02 82 190

Structural Neighbourhood (27 entries)

There are 27 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 27 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2a2rA02 91.48 Anti-apoptosisPathways in cancerCentral nervous system developmentGlutathione S-transferase PGlutathione metabolism 1.20.1050.10 108 31 96 1.62 1.68
1dugA02 90.56 Fibrinogen gamma chainGlutathione S-transferase class-mu 26 kDa isozymeExternal side of plasma membraneFibrinogen complexEukaryotic cell surface binding 1.20.1050.10 105 24 95 1.39 1.46
2cvdA02 89.94 CytoplasmProstaglandin-H2 D-isomerase [EC:5.3.99.2]Arachidonic acid metabolismProstaglandin-D synthase activityHematopoietic prostaglandin D synthase 1.20.1050.10 108 13 96 1.56 1.62
2gsqA02 89.73 Ommastrephes sloaniGlutathione S-transferase 1.20.1050.10 108 25 97 1.46 1.50
3fr3B02 89.45 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 1.20.1050.10 114 26 87 1.97 2.25
2c4jA02 89.06 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Metabolism of xenobiotics by cytochrome P450Glutathione S-transferase Mu 2Homo sapiens 1.20.1050.10 105 18 95 1.60 1.68
3h1nA02 88.98 Bordetella bronchisepticaProbable glutathione S-transferase 1.20.1050.10 115 20 89 1.59 1.78
1m0uA02 88.00 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase S1Metabolism of xenobiotics by cytochrome P450Glutathione peroxidase activity 1.20.1050.10 112 20 94 2.24 2.37
1oe8A02 87.00 Schistosoma haematobiumGlutathione S-transferase class-mu 28 kDa isozyme 1.20.1050.10 124 21 87 2.31 2.65
1eemA02 86.00 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Glutathione S-transferase omega-1Metabolism of xenobiotics by cytochrome P450Homo sapiens 1.20.1050.10 115 19 91 2.97 3.25
2cz2A02 85.73 Tyrosine metabolismGlutathione transferase activityGlutathione metabolismMetabolic pathwaysGlutathione S-transferase [EC:2.5.1.18] 1.20.1050.10 122 21 81 2.20 2.68
1n2aA02 85.33 Metabolism of xenobiotics by cytochrome P450Glutathione metabolismGlutathione S-transferase [EC:2.5.1.18]Glutathione S-transferaseEscherichia coli K-12 1.20.1050.10 106 9 91 2.30 2.51
2v6kA02 85.22 Maleylpyruvate isomeraseRalstonia sp. U2 1.20.1050.10 130 17 81 2.19 2.69
1e6bA02 84.32 Arabidopsis thalianaToxin catabolic processGlutathione S-transferase zeta-class 1 1.20.1050.10 111 13 82 3.53 4.26
3f6dB02 84.30 Anopheles dirusGlutathione transferase GST1-4 1.20.1050.10 123 12 78 2.36 3.02
2dsaA02 84.17 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismBurkholderia xenovorans LB400 1.20.1050.10 106 17 88 4.01 4.55
1gnwA02 83.39 Glutathione bindingMicrosomeChloroplast stromaPlasma membraneToxin catabolic process 1.20.1050.10 125 16 84 3.48 4.10
1v2aA02 83.20 Anopheles dirusGlutathione transferase gst1-6 1.20.1050.10 132 21 78 2.90 3.68
1aw9A02 82.66 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 16 86 3.08 3.55
1nhyA02 82.18 Positive regulation of transcription from RNA polymerase II promoterCalcium ion bindingNucleusElongation factor 1-gamma 1Transcription coactivator activity 1.20.1050.10 139 16 75 2.83 3.75
1gwcA02 82.08 Aegilops tauschiiGlutathione S-transferase 1 1.20.1050.10 141 16 74 2.33 3.13
2pvqA02 80.25 Glutathione S-transferaseOchrobactrum anthropi 1.20.1050.10 104 10 89 3.62 4.03
1hqoA02 80.24 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 1.20.1050.10 126 15 81 3.24 3.96
2vo4A02 80.19 2,4-D inducible glutathione S-transferaseGlycine max 1.20.1050.10 132 16 75 2.74 3.62
3ir4A02 78.51 Glutaredoxin 2Salmonella enterica subsp. enterica serovar TyphimuriumGlutaredoxin 2 1.20.1050.10 124 12 69 2.77 3.99
2c3nA02 78.31 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 1.20.1050.10 160 18 66 3.17 4.74
3cbuA02 77.13 Glutathione S-transferase [EC:2.5.1.18]Ralstonia eutropha JMP134Metabolism of xenobiotics by cytochrome P450Probable gst-related proteinGlutathione metabolism 1.20.1050.10 132 14 77 3.57 4.62
[1]
Displaying entries 1 to 27 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1k3yA02
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1k3yA02
YGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLV
ELLYYVEELDSSLISSFPLLKALKTRISN
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:20

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:01

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"