Set cath from cathlist by auto on 05 Mar 2006 18:46
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1k3iA01 | -1 | 153 |
| 1k3iA02 | 154 | 541 |
| 1k3iA03 | 542 | 638 |
There are 13 matching structural neighberhood comparisons for CATH ID 2.60.120.260.12.1.1.1.1 (SIMAX score < 5)
>pdb|1k3iA01 RASAPIGSAISRNNWAVTCDSAQSGNECNKAIDGNKDTFWHTFYGANGDPKPPHTYTIDMKTTQNVNGLSMLPRQDGNQN GWIGRHEVYLSSDGTNWGSPVASGSWFADSTTKYSNFETRPARYVRLVAITEANGQPWTSIAEINVFQASSYTA
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"